PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC8501_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family ARF
Protein Properties Length: 834aa    MW: 92323 Da    PI: 6.5552
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC8501_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3604.2e-19149232179
                 EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-E CS
          B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDf 79 
                 f+k+lt sd++++g +++p++ ae++       + +++  ++++ +d++  +W++++iyr++++r++lt+GW+ Fv+ ++L +gD+
  RrC8501_p2 149 FCKTLTASDTSTHGGFSVPRRAAEKIfppldfsM-QPPA-QEIVAKDLHDTTWTFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDS 232
                 99*****************************954.4444.48******************************************97 PP

2Auxin_resp1193.8e-39268350183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 aaha +++s+F++++nPras+seFvv+++k++kal+ +vs+GmRf+m+feted+  rr++Gtv+g+sdldpvrW++S+Wr+L+
  RrC8501_p2 268 AAHANANSSPFTIFFNPRASPSEFVVPLAKYNKALYAQVSLGMRFRMMFETEDCGVRRYMGTVTGISDLDPVRWKGSQWRNLQ 350
                 799******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019368.76E-40139271IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.6E-34143257IPR015300DNA-binding pseudobarrel domain
CDDcd100171.22E-17148242No hitNo description
PROSITE profilePS5086310.109149258IPR003340B3 DNA binding domain
PfamPF023623.0E-17149232IPR003340B3 DNA binding domain
SMARTSM010195.6E-16149244IPR003340B3 DNA binding domain
PfamPF065075.3E-34268350IPR010525Auxin response factor
PROSITE profilePS5174523.609766834IPR000270PB1 domain
SuperFamilySSF542771.67E-5780834No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0010311Biological Processlateral root formation
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 834 aa     Download sequence    Send to blast
MPQIFDKASD FLHEYREKKA INSQLWHACA GPLVSLPPVG SLVVYFPQGH SEQVMVPKQQ  60
FFSVAASMQK QTDFIPNYPN LPSKLICLLH SVTLHADTET DEVYAQMTLQ PVNKLNLCLI  120
TQNVYQYDRE ALLASDMGLK INRQPTEFFC KTLTASDTST HGGFSVPRRA AEKIFPPLDF  180
SMQPPAQEIV AKDLHDTTWT FRHIYRGQPK RHLLTTGWSV FVSTKRLFAG DSKSQLTLGI  240
RRANRQTPTL SSSVISSDSM HIGILAAAAH ANANSSPFTI FFNPRASPSE FVVPLAKYNK  300
ALYAQVSLGM RFRMMFETED CGVRRYMGTV TGISDLDPVR WKGSQWRNLQ VMCSILIISS  360
ESFAEKAFVR LFEQVGWDES TAGDRPSRVS IWEIEPVITP FYICPPPFFR PKYPRQPGMP  420
DDELDMENAF KRAMPWMGEE FGMKDAQSSM FPGLSLSQLQ QQLMLSNGLV SNDSARIAVS  480
AATGVAQQYP IIEKPAGTVV YASATTKSPL PQSNNSFMQP PQIQVSHHQQ QGYMNNNNKP  540
VVAAGRSQSG HIDGEAPSCS TSPSANNTGG HDNVSPTNFL SRNQQQGQAV SVSVPVPVPA  600
SDSVFERASN PVQQGMVNLK SATEQFKFKG AVTDQIDVTT VGTTYCPDVV GPGQQQQQQQ  660
QTFPLPSFGF DGDLQTHHPR NNLAYAGNLE AVNPDALYSQ KDFQNLVPNY GNAPRDIETE  720
LSSASQSFGI PSIPFKSGGS NEIGGINDSG IMNGGGIWPN QAQRMRTYTK VQKRGSVGRS  780
IDVTRYSGYE ELRHDLARMF GIEGQLEDPQ TSDWKLVYTD HENDILLVGD DPWE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1541739547388Auxin response factor 5
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9794840.0JN979484.1 Brassica rapa subsp. pekinensis auxin response factor 19-2 (ARF19-2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013586633.10.0PREDICTED: auxin response factor 19 isoform X1
SwissprotQ8RYC80.0ARFS_ARATH; Auxin response factor 19
TrEMBLA0A103Y2650.0A0A103Y265_CYNCS; Auxin response factor
STRINGBra025720.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26292665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19